Lineage for d1zesc1 (1zes C:3-122)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691711Protein PhoB receiver domain [52192] (2 species)
  7. 691712Species Escherichia coli [TaxId:562] [52193] (3 PDB entries)
  8. 691715Domain d1zesc1: 1zes C:3-122 [124996]
    automatically matched to d1b00a_
    complexed with bef, mg; mutant

Details for d1zesc1

PDB Entry: 1zes (more details), 1.9 Å

PDB Description: BeF3- activated PhoB receiver domain
PDB Compounds: (C:) phosphate regulon transcriptional regulatory protein phob

SCOP Domain Sequences for d1zesc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zesc1 c.23.1.1 (C:3-122) PhoB receiver domain {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

SCOP Domain Coordinates for d1zesc1:

Click to download the PDB-style file with coordinates for d1zesc1.
(The format of our PDB-style files is described here.)

Timeline for d1zesc1: