SCOPe 2.04: Domain d1ze3c1: 1ze3 C:1-121

Lineage for d1ze3c1 (1ze3 C:1-121)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)

8. Domain d1ze3c1: 1ze3 C:1-121 [124974]
   Other proteins in same PDB: d1ze3c2, d1ze3d1, d1ze3h_
   automated match to d1bf8a1
   complexed with edo

Details for d1ze3c1

PDB Entry: 1ze3, 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d1ze3c1:

Sequence; same for both SEQRES and ATOM records:

>d1ze3c1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d1ze3c1:

• d1ze3c1 first appeared in SCOP 1.73
  
• d1ze3c1 appears in SCOPe 2.03
  
• d1ze3c1 appears in SCOPe 2.05
  
• d1ze3c1 appears in the current release, SCOPe 2.08