Lineage for d1zcsa1 (1zcs A:81-193)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770727Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 770728Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 770729Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 770736Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 770739Species Desulfovibrio gigas [TaxId:879] [47744] (3 PDB entries)
    Uniprot Q46509
  8. 770741Domain d1zcsa1: 1zcs A:81-193 [124912]
    Other proteins in same PDB: d1zcsa2, d1zcsa3, d1zcsa4
    automatically matched to d1sija1
    complexed with ast, cl, fes, ipa, mg, pcd

Details for d1zcsa1

PDB Entry: 1zcs (more details), 1.45 Å

PDB Description: Crystal Structure of the Arsenite-Inhibited and Reduced Form of Aldehyde Oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOP Domain Sequences for d1zcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcsa1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOP Domain Coordinates for d1zcsa1:

Click to download the PDB-style file with coordinates for d1zcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1zcsa1: