SCOP 1.73: Domain d1zcab1: 1zca B:83-204

Lineage for d1zcab1 (1zca B:83-204)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (3 PDB entries)

8. Domain d1zcab1: 1zca B:83-204 [124899]
   Other proteins in same PDB: d1zcaa2, d1zcab2
   automatically matched to 1ZCA A:83-204
   complexed with alf, gdp, mg

Details for d1zcab1

PDB Entry: 1zca, 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-

PDB Compounds: (B:) G alpha i/12

SCOP Domain Sequences for d1zcab1:

Sequence; same for both SEQRES and ATOM records:

>d1zcab1 a.66.1.1 (B:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpvep
atfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdilla
rk

Timeline for d1zcab1:

• d1zcab1 is new in SCOP 1.73
  
• d1zcab1 appears in SCOP 1.75
  
• d1zcab1 appears in the current release, SCOPe 2.08