Class b: All beta proteins [48724] (177 folds) |
Fold b.111: Small protein B (SmpB) [74981] (1 superfamily) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) |
Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries) Uniprot Q8RR57 4-123 |
Domain d1zc8k1: 1zc8 K:1-130 [124892] Other proteins in same PDB: d1zc8y1, d1zc8y2, d1zc8y3 automatically matched to d1k8ha_ protein/RNA complex |
PDB Entry: 1zc8 (more details), 13 Å
SCOPe Domain Sequences for d1zc8k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc8k1 b.111.1.1 (K:1-130) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv lialakgkkl
Timeline for d1zc8k1: