Lineage for d1zbwa1 (1zbw A:1-239,A:308-362)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816611Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 816618Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries)
  8. 816624Domain d1zbwa1: 1zbw A:1-239,A:308-362 [124874]
    Other proteins in same PDB: d1zbwa2
    automatically matched to d1ljya1
    complexed with nag

Details for d1zbwa1

PDB Entry: 1zbw (more details), 2.8 Å

PDB Description: crystal structure of the complex formed between signalling protein from goat mammary gland (spg-40) and a tripeptide trp-pro-trp at 2.8a resolution
PDB Compounds: (A:) chitinase-3 like protein 1

SCOP Domain Sequences for d1zbwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbwa1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlarv

SCOP Domain Coordinates for d1zbwa1:

Click to download the PDB-style file with coordinates for d1zbwa1.
(The format of our PDB-style files is described here.)

Timeline for d1zbwa1: