SCOPe 2.08: Domain d1zbsa2: 1zbs A:1-107

Lineage for d1zbsa2 (1zbs A:1-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)

6. Protein Hypothetical protein PG1100, N-terminal domain [418990] (1 species)
7. Species Porphyromonas gingivalis [TaxId:837] [419462] (1 PDB entry)
   Uniprot Q7MVG4

8. Domain d1zbsa2: 1zbs A:1-107 [124871]
   Other proteins in same PDB: d1zbsa1

Details for d1zbsa2

PDB Entry: 1zbs, 2.3 Å

PDB Description: crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18

PDB Compounds: (A:) hypothetical protein PG1100

SCOPe Domain Sequences for d1zbsa2:

Sequence; same for both SEQRES and ATOM records:

>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassi
ravyfygagctpakapmlnealdsmlphcdrievagdmlgaaralcg

Timeline for d1zbsa2:

• d1zbsa2 first appeared in SCOP 1.73
  
• d1zbsa2 appears in SCOPe 2.07