![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (33 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d1za6h3: 1za6 H:239-344 [124817] Other proteins in same PDB: d1za6a1, d1za6a2, d1za6b1, d1za6b2, d1za6c1, d1za6c2, d1za6d1, d1za6d2, d1za6e1, d1za6e2, d1za6f1, d1za6f2, d1za6g1, d1za6g2, d1za6h1, d1za6h2 automatically matched to d1hzhh4 |
PDB Entry: 1za6 (more details), 2.8 Å
SCOPe Domain Sequences for d1za6h3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za6h3 b.1.1.2 (H:239-344) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
Timeline for d1za6h3: