Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1za6b2: 1za6 B:116-218 [124807] Other proteins in same PDB: d1za6a1, d1za6a2, d1za6b1, d1za6b3, d1za6c1, d1za6c2, d1za6d1, d1za6d3, d1za6e1, d1za6e2, d1za6f1, d1za6f3, d1za6g1, d1za6g2, d1za6h1, d1za6h3 automatically matched to d1ngzb2 |
PDB Entry: 1za6 (more details), 2.8 Å
SCOPe Domain Sequences for d1za6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za6b2 b.1.1.2 (B:116-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1za6b2: