Lineage for d1za6b1 (1za6 B:2-115)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510931Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1511121Domain d1za6b1: 1za6 B:2-115 [124806]
    Other proteins in same PDB: d1za6a1, d1za6a2, d1za6b2, d1za6b3, d1za6c1, d1za6c2, d1za6d2, d1za6d3, d1za6e1, d1za6e2, d1za6f2, d1za6f3, d1za6g1, d1za6g2, d1za6h2, d1za6h3
    automatically matched to d1igyb1

Details for d1za6b1

PDB Entry: 1za6 (more details), 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody
PDB Compounds: (B:) IGG Heavy chain

SCOPe Domain Sequences for d1za6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za6b1 b.1.1.1 (B:2-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfkyn
erfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvss

SCOPe Domain Coordinates for d1za6b1:

Click to download the PDB-style file with coordinates for d1za6b1.
(The format of our PDB-style files is described here.)

Timeline for d1za6b1: