Lineage for d1za3s2 (1za3 S:62-101)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749631Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 749632Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 749633Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 749642Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 749643Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 749681Domain d1za3s2: 1za3 S:62-101 [124799]
    Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l1, d1za3l2
    automatically matched to d1d0gr2

Details for d1za3s2

PDB Entry: 1za3 (more details), 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5
PDB Compounds: (S:) Tumor necrosis factor receptor superfamily member 10B

SCOP Domain Sequences for d1za3s2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za3s2 g.24.1.1 (S:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOP Domain Coordinates for d1za3s2:

Click to download the PDB-style file with coordinates for d1za3s2.
(The format of our PDB-style files is described here.)

Timeline for d1za3s2: