![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (45 PDB entries) |
![]() | Domain d1za1a1: 1za1 A:1-150 [124775] Other proteins in same PDB: d1za1b1, d1za1b2, d1za1d1, d1za1d2 automatically matched to d1ekxa1 complexed with ctp, zn |
PDB Entry: 1za1 (more details), 2.2 Å
SCOP Domain Sequences for d1za1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za1a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1za1a1: