Lineage for d1z9hc2 (1z9h C:100-212)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853382Protein Microsomal prostaglandin E synthase-2 [142363] (1 species)
  7. 1853383Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries)
    Uniprot Q9N0A4 100-212
  8. 1853386Domain d1z9hc2: 1z9h C:100-212 [124763]
    Other proteins in same PDB: d1z9ha1, d1z9hb1, d1z9hc1, d1z9hd1
    automated match to d1z9ha2
    complexed with act, cl, imn

Details for d1z9hc2

PDB Entry: 1z9h (more details), 2.6 Å

PDB Description: microsomal prostaglandin e synthase type-2
PDB Compounds: (C:) membrane-associated prostaglandin E synthase-2

SCOPe Domain Sequences for d1z9hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9hc2 c.47.1.5 (C:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess
qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm

SCOPe Domain Coordinates for d1z9hc2:

Click to download the PDB-style file with coordinates for d1z9hc2.
(The format of our PDB-style files is described here.)

Timeline for d1z9hc2: