SCOPe 2.04: Domain d1z9ha1: 1z9h A:213-373

Lineage for d1z9ha1 (1z9h A:213-373)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Microsomal prostaglandin E synthase-2 [140556] (1 species)

7. Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries)
   Uniprot Q9N0A4 213-373

8. Domain d1z9ha1: 1z9h A:213-373 [124758]
   Other proteins in same PDB: d1z9ha2, d1z9hb2, d1z9hc2, d1z9hd2
   complexed with act, cl, imn

Details for d1z9ha1

PDB Entry: 1z9h, 2.6 Å

PDB Description: microsomal prostaglandin e synthase type-2

PDB Compounds: (A:) membrane-associated prostaglandin E synthase-2

SCOPe Domain Sequences for d1z9ha1:

Sequence; same for both SEQRES and ATOM records:

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga
vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl
adlavygvlrvmegldafddlmqhthiqpwylrveraitea

Timeline for d1z9ha1:

• d1z9ha1 first appeared in SCOP 1.73
  
• d1z9ha1 appears in SCOPe 2.03
  
• d1z9ha1 appears in SCOPe 2.05
  
• d1z9ha1 appears in the current release, SCOPe 2.08