SCOPe 2.01: Domain d1z9cd_: 1z9c D:

Lineage for d1z9cd_ (1z9c D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Organic hydroperoxide resistance transcriptional regulator OhrR [140247] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140248] (2 PDB entries)
   Uniprot O34777 8-144

8. Domain d1z9cd_: 1z9c D: [124750]
   automated match to d1z91a1
   protein/DNA complex

Details for d1z9cd_

PDB Entry: 1z9c, 2.64 Å

PDB Description: crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna

PDB Compounds: (D:) Organic hydroperoxide resistance transcriptional regulator

SCOPe Domain Sequences for d1z9cd_:

Sequence; same for both SEQRES and ATOM records:

>d1z9cd_ a.4.5.28 (D:) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}
mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
dlkqlksalytlletlh

Timeline for d1z9cd_:

• d1z9cd_ first appeared in SCOP 1.73, called d1z9cd1
  
• d1z9cd_ was called d1z9cd1 in SCOP 1.75
  
• d1z9cd_ appears in SCOPe 2.02
  
• d1z9cd_ appears in the current release, SCOPe 2.08