Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Organic hydroperoxide resistance transcriptional regulator OhrR [140247] (1 species) |
Species Bacillus subtilis [TaxId:1423] [140248] (2 PDB entries) Uniprot O34777 8-144 |
Domain d1z9cc_: 1z9c C: [124749] automated match to d1z91a1 protein/DNA complex |
PDB Entry: 1z9c (more details), 2.64 Å
SCOPe Domain Sequences for d1z9cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9cc_ a.4.5.28 (C:) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} hmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyl dsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsg edlkqlksalytlletlh
Timeline for d1z9cc_: