Lineage for d1z94f_ (1z94 F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431435Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
    Pfam PF05146
  6. 1431450Protein Hypothetical protein CV1439 [143835] (1 species)
  7. 1431451Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry)
    Uniprot Q7NY36 2-144
  8. 1431457Domain d1z94f_: 1z94 F: [124745]
    automated match to d1z94a1

Details for d1z94f_

PDB Entry: 1z94 (more details), 2.1 Å

PDB Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.
PDB Compounds: (F:) conserved hypothetical protein

SCOPe Domain Sequences for d1z94f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z94f_ d.129.3.5 (F:) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
ppencylgwqqslkqlaalvepd

SCOPe Domain Coordinates for d1z94f_:

Click to download the PDB-style file with coordinates for d1z94f_.
(The format of our PDB-style files is described here.)

Timeline for d1z94f_: