SCOP 1.73: Domain d1z94c1: 1z94 C:2-144

Lineage for d1z94c1 (1z94 C:2-144)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (7 proteins)
   Pfam PF05146

6. Protein Hypothetical protein CV1439 [143835] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry)

8. Domain d1z94c1: 1z94 C:2-144 [124742]
   automatically matched to 1Z94 A:2-144

Details for d1z94c1

PDB Entry: 1z94, 2.1 Å

PDB Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.

PDB Compounds: (C:) conserved hypothetical protein

SCOP Domain Sequences for d1z94c1:

Sequence; same for both SEQRES and ATOM records:

>d1z94c1 d.129.3.5 (C:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
ppencylgwqqslkqlaalvepd

Timeline for d1z94c1:

• d1z94c1 is new in SCOP 1.73
  
• d1z94c1 appears in SCOP 1.75
  
• d1z94c1 appears in the current release, SCOPe 2.08, called d1z94c_