![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (11 proteins) Pfam PF05146 |
![]() | Protein Hypothetical protein CV1439 [143835] (1 species) |
![]() | Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry) Uniprot Q7NY36 2-144 |
![]() | Domain d1z94b_: 1z94 B: [124741] automated match to d1z94a1 |
PDB Entry: 1z94 (more details), 2.1 Å
SCOPe Domain Sequences for d1z94b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z94b_ d.129.3.5 (B:) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda ippencylgwqqslkqlaalvepd
Timeline for d1z94b_: