![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (7 proteins) Pfam PF05146 |
![]() | Protein Hypothetical protein CV1439 [143835] (1 species) |
![]() | Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry) |
![]() | Domain d1z94a1: 1z94 A:2-144 [124740] |
PDB Entry: 1z94 (more details), 2.1 Å
SCOP Domain Sequences for d1z94a1:
Sequence, based on SEQRES records: (download)
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai ppencylgwqqslkqlaalvepd
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas gqkhafggrylelvpgerirytdrfddagdmittitlaplscgadlsivqegipdaippe ncylgwqqslkqlaalvepd
Timeline for d1z94a1: