Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein Viral capsid protein [50597] (3 species) |
Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries) |
Domain d1z8yt1: 1z8y T:114-264 [124731] automatically matched to d1kxf__ |
PDB Entry: 1z8y (more details), 9 Å
SCOP Domain Sequences for d1z8yt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8yt1 b.47.1.3 (T:114-264) Viral capsid protein {Sindbis virus [TaxId: 11034]} rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg adegtrtalsvvtwnskgktikttpegteew
Timeline for d1z8yt1: