Lineage for d1z8uc_ (1z8u C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481665Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)
    automatically mapped to Pfam PF09236
  5. 1481666Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
    this is a repeat family; one repeat unit is 1w0a A: found in domain
  6. 1481667Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 1481668Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries)
    Uniprot Q9NZD4 1-94
  8. 1481670Domain d1z8uc_: 1z8u C: [124726]
    Other proteins in same PDB: d1z8ub_, d1z8ud_
    automated match to d1w0ba_
    complexed with hem

Details for d1z8uc_

PDB Entry: 1z8u (more details), 2.4 Å

PDB Description: crystal structure of oxidized alpha hemoglobin bound to ahsp
PDB Compounds: (C:) alpha-hemoglobin stabilizing protein

SCOPe Domain Sequences for d1z8uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8uc_ a.7.11.1 (C:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
mallkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgep
qerdkalqelrqelntlanpflakyrdflks

SCOPe Domain Coordinates for d1z8uc_:

Click to download the PDB-style file with coordinates for d1z8uc_.
(The format of our PDB-style files is described here.)

Timeline for d1z8uc_: