Lineage for d1z8ua1 (1z8u A:2-91)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764169Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)
  5. 764170Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
  6. 764171Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 764172Species Human (Homo sapiens) [TaxId:9606] [109754] (6 PDB entries)
    Uniprot Q9NZD4 1-94
  8. 764173Domain d1z8ua1: 1z8u A:2-91 [124724]
    Other proteins in same PDB: d1z8ub1, d1z8ud1
    automatically matched to d1w0ba_
    complexed with hem; mutant

Details for d1z8ua1

PDB Entry: 1z8u (more details), 2.4 Å

PDB Description: Crystal structure of oxidized alpha hemoglobin bound to AHSP
PDB Compounds: (A:) alpha-hemoglobin stabilizing protein

SCOP Domain Sequences for d1z8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ua1 a.7.11.1 (A:2-91) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
allkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgepq
erdkalqelrqelntlanpflakyrdflks

SCOP Domain Coordinates for d1z8ua1:

Click to download the PDB-style file with coordinates for d1z8ua1.
(The format of our PDB-style files is described here.)

Timeline for d1z8ua1: