Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species) |
Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (12 PDB entries) Uniprot P17597 460-667 |
Domain d1z8na3: 1z8n A:460-667 [124721] Other proteins in same PDB: d1z8na1, d1z8na2 automated match to d1ybha3 complexed with 1iq, fad, mg, nhe, tpp |
PDB Entry: 1z8n (more details), 2.8 Å
SCOPe Domain Sequences for d1z8na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8na3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv icphqehvlpmipsggtfndvitegdgr
Timeline for d1z8na3: