Lineage for d1z7zi5 (1z7z I:367-450)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295571Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 1295572Species Human (Homo sapiens) [TaxId:9606] [49163] (7 PDB entries)
  8. 1295583Domain d1z7zi5: 1z7z I:367-450 [124684]
    Other proteins in same PDB: d1z7zi1, d1z7zi2
    automatically matched to d1p53a3
    complexed with nag, ndg

Details for d1z7zi5

PDB Entry: 1z7z (more details), 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1z7zi5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7zi5 b.1.1.4 (I:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
ygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdleg
tylcrarstqgevtrevtvnvlsp

SCOPe Domain Coordinates for d1z7zi5:

Click to download the PDB-style file with coordinates for d1z7zi5.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi5: