Lineage for d1z7zi3 (1z7z I:1-82)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 657024Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 657025Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries)
  8. 657031Domain d1z7zi3: 1z7z I:1-82 [124682]
    Other proteins in same PDB: d1z7zi1, d1z7zi2
    automatically matched to d1d3la2
    complexed with nag, ndg; mutant

Details for d1z7zi3

PDB Entry: 1z7z (more details), 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOP Domain Sequences for d1z7zi3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7zi3 b.1.1.4 (I:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpmllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOP Domain Coordinates for d1z7zi3:

Click to download the PDB-style file with coordinates for d1z7zi3.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi3: