SCOPe 2.07: Domain d1z7zi2: 1z7z I:283-366

Lineage for d1z7zi2 (1z7z I:283-366)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d1z7zi2: 1z7z I:283-366 [124681]
   Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5
   automatically matched to d1p53a1
   complexed with nag, ndg

Details for d1z7zi2

PDB Entry: 1z7z, 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi

PDB Compounds: (I:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1z7zi2:

Sequence, based on SEQRES records:

>d1z7zi2 b.1.1.3 (I:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

Sequence, based on observed residues (ATOM records):

>d1z7zi2 b.1.1.3 (I:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceagpraqlllkatpedngrsfscsatlevagqlihkn
qtrelrvl

Timeline for d1z7zi2:

• d1z7zi2 first appeared in SCOP 1.73
  
• d1z7zi2 appears in SCOPe 2.06
  
• d1z7zi2 appears in the current release, SCOPe 2.08