Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (3 families) regular structure consisting of similar repeats |
Family c.10.1.1: 28-residue LRR [52048] (2 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
Protein Ribonuclease inhibitor [52049] (2 species) duplication: consists of 16 repeats |
Species Human (Homo sapiens) [TaxId:9606] [52051] (4 PDB entries) |
Domain d1z7xy1: 1z7x Y:1-460 [124677] Other proteins in same PDB: d1z7xx1, d1z7xz1 automatically matched to d1a4ya_ complexed with cit |
PDB Entry: 1z7x (more details), 1.95 Å
SCOP Domain Sequences for d1z7xy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7xy1 c.10.1.1 (Y:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} sldiqsldiqceelsdarwaellpllqqcqvvrlddcgltearckdissalrvnpalael nlrsnelgdvgvhcvlqglqtpsckiqklslqnccltgagcgvlsstlrtlptlqelhls dnllgdaglqllceglldpqcrleklqleycslsaasceplasvlrakpdfkeltvsnnd ineagvrvlcqglkdspcqlealklescgvtsdncrdlcgivaskaslrelalgsnklgd vgmaelcpgllhpssrlrtlwiwecgitakgcgdlcrvlrakeslkelslagnelgdega rllcetllepgcqleslwvkscsftaaccshfssvlaqnrfllelqisnnrledagvrel cqglgqpgsvlrvlwladcdvsdsscsslaatllanhslreldlsnnclgdagilqlves vrqpgclleqlvlydiywseemedrlqalekdkpslrvis
Timeline for d1z7xy1: