Lineage for d1z7qh1 (1z7q H:2-196)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736244Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 736289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (9 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 736402Domain d1z7qh1: 1z7q H:2-196 [124655]
    Other proteins in same PDB: d1z7qa1, d1z7qb1, d1z7qc1, d1z7qd1, d1z7qe1, d1z7qf1, d1z7qg1, d1z7qo1, d1z7qp1, d1z7qq1, d1z7qr1, d1z7qs1, d1z7qt1, d1z7qu1
    automatically matched to d1ryph_

Details for d1z7qh1

PDB Entry: 1z7q (more details), 3.22 Å

PDB Description: Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator PA26 from Trypanosome brucei at 3.2 angstroms resolution
PDB Compounds: (H:) Proteasome component PRE3

SCOP Domain Sequences for d1z7qh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7qh1 d.153.1.4 (H:2-196) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivqy
hlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvhk
lpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvltaa
gverlifypdeyeql

SCOP Domain Coordinates for d1z7qh1:

Click to download the PDB-style file with coordinates for d1z7qh1.
(The format of our PDB-style files is described here.)

Timeline for d1z7qh1: