Lineage for d1z7kb1 (1z7k B:2-63)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751855Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 751856Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 751857Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 751889Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 751901Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (35 PDB entries)
  8. 751915Domain d1z7kb1: 1z7k B:2-63 [124631]
    Other proteins in same PDB: d1z7ka1
    automatically matched to d1r0tb_
    complexed with nag

Details for d1z7kb1

PDB Entry: 1z7k (more details), 1.9 Å

PDB Description: crystal structure of trypsin- ovomucoid turkey egg white inhibitor complex
PDB Compounds: (B:) Ovomucoid

SCOP Domain Sequences for d1z7kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg
ec

SCOP Domain Coordinates for d1z7kb1:

Click to download the PDB-style file with coordinates for d1z7kb1.
(The format of our PDB-style files is described here.)

Timeline for d1z7kb1: