Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
Domain d1z6yb_: 1z6y B: [124574] automated match to d1r8qa_ complexed with gdp |
PDB Entry: 1z6y (more details), 2.4 Å
SCOPe Domain Sequences for d1z6yb_:
Sequence, based on SEQRES records: (download)
>d1z6yb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf lmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkaglli fankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr
>d1z6yb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf lmwdiggqeslrsyytntefvivvvdstdrerisvtreelykmlahedlrkagllifank qdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr
Timeline for d1z6yb_: