SCOPe 2.06: Domain d1z6xb_: 1z6x B:

Lineage for d1z6xb_ (1z6x B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry)
   Uniprot P18085 3-177

8. Domain d1z6xb_: 1z6x B: [124572]
   automated match to d1hura_
   complexed with gdp, mg

Details for d1z6xb_

PDB Entry: 1z6x, 2.7 Å

PDB Description: Structure Of Human ADP-Ribosylation Factor 4

PDB Compounds: (B:) ADP-ribosylation factor 4

SCOPe Domain Sequences for d1z6xb_:

Sequence; same for both SEQRES and ATOM records:

>d1z6xb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]}
tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels

Timeline for d1z6xb_:

• d1z6xb_ first appeared in SCOP 1.73, called d1z6xb1
  
• d1z6xb_ appears in SCOPe 2.05
  
• d1z6xb_ appears in SCOPe 2.07
  
• d1z6xb_ appears in the current release, SCOPe 2.08