Lineage for d1z6xa1 (1z6x A:4-178)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695635Protein ADP-ribosylation factor [52614] (14 species)
  7. 695661Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry)
  8. 695662Domain d1z6xa1: 1z6x A:4-178 [124571]
    complexed with gdp, mg

Details for d1z6xa1

PDB Entry: 1z6x (more details), 2.7 Å

PDB Description: Structure Of Human ADP-Ribosylation Factor 4
PDB Compounds: (A:) ADP-ribosylation factor 4

SCOP Domain Sequences for d1z6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6xa1 c.37.1.8 (A:4-178) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]}
tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels

SCOP Domain Coordinates for d1z6xa1:

Click to download the PDB-style file with coordinates for d1z6xa1.
(The format of our PDB-style files is described here.)

Timeline for d1z6xa1: