Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Trichoplusia ni [TaxId:7111] [186900] (1 PDB entry) |
Domain d1z6ov_: 1z6o V: [124552] Other proteins in same PDB: d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1 automated match to d1rcd__ complexed with ca, fe |
PDB Entry: 1z6o (more details), 1.91 Å
SCOPe Domain Sequences for d1z6ov_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6ov_ a.25.1.0 (V:) automated matches {Trichoplusia ni [TaxId: 7111]} tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef ifdkkllgidv
Timeline for d1z6ov_: