Lineage for d1z6ot_ (1z6o T:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085586Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1085587Protein automated matches [190036] (15 species)
    not a true protein
  7. 1085804Species Trichoplusia ni [TaxId:7111] [186900] (1 PDB entry)
  8. 1085811Domain d1z6ot_: 1z6o T: [124550]
    Other proteins in same PDB: d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1
    automated match to d1rcd__
    complexed with ca, fe

Details for d1z6ot_

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (T:) ferritin heavy chain

SCOPe Domain Sequences for d1z6ot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6ot_ a.25.1.0 (T:) automated matches {Trichoplusia ni [TaxId: 7111]}
tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
ifdkkllgidv

SCOPe Domain Coordinates for d1z6ot_:

Click to download the PDB-style file with coordinates for d1z6ot_.
(The format of our PDB-style files is described here.)

Timeline for d1z6ot_: