Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein (Apo)ferritin [47246] (8 species) |
Species Cabbage looper (Trichoplusia ni), H chain [TaxId:7111] [140437] (1 PDB entry) Uniprot Q8WQX3 21-211 |
Domain d1z6om1: 1z6o M:1-191 [124543] Other proteins in same PDB: d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ow_, d1z6ox_ complexed with ca, fe |
PDB Entry: 1z6o (more details), 1.91 Å
SCOPe Domain Sequences for d1z6om1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper (Trichoplusia ni), H chain [TaxId: 7111]} tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef ifdkkllgidv
Timeline for d1z6om1: