Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (21 species) not a true protein |
Species Trichoplusia ni [TaxId:7111] [188170] (1 PDB entry) |
Domain d1z6oc_: 1z6o C: [124533] Other proteins in same PDB: d1z6oa1, d1z6om1, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ow_, d1z6ox_ automated match to d1z6oa1 complexed with ca, fe |
PDB Entry: 1z6o (more details), 1.91 Å
SCOPe Domain Sequences for d1z6oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6oc_ a.25.1.1 (C:) automated matches {Trichoplusia ni [TaxId: 7111]} adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag htsdlkkfitannghdlslalyvfdeylqktv
Timeline for d1z6oc_: