Lineage for d1z66a1 (1z66 A:303-395)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658925Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 658926Protein Envelope glycoprotein [49213] (5 species)
  7. 658945Species Langat virus [TaxId:11085] [141022] (2 PDB entries)
  8. 658946Domain d1z66a1: 1z66 A:303-395 [124506]
    automatically matched to 2GG1 A:303-395

Details for d1z66a1

PDB Entry: 1z66 (more details)

PDB Description: nmr solution structure of domain iii of e-protein of tick-borne langat flavivirus (no rdc restraints)
PDB Compounds: (A:) major envelope protein E

SCOP Domain Sequences for d1z66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z66a1 b.1.18.4 (A:303-395) Envelope glycoprotein {Langat virus [TaxId: 11085]}
tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
tmenngggfiemqlppgdniiyvgdlnhqwfqk

SCOP Domain Coordinates for d1z66a1:

Click to download the PDB-style file with coordinates for d1z66a1.
(The format of our PDB-style files is described here.)

Timeline for d1z66a1: