Lineage for d1z5ca3 (1z5c A:4-228)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537498Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2537539Protein Topoisomerase VI-B subunit [82778] (1 species)
    contains an H2TH domain inserted after this domain and before the second family-specific domain
  7. 2537540Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)
  8. 2537546Domain d1z5ca3: 1z5c A:4-228 [124472]
    Other proteins in same PDB: d1z5ca1, d1z5ca2, d1z5cb1, d1z5cb2
    automated match to d2hkja3
    complexed with adp, mg, po4

Details for d1z5ca3

PDB Entry: 1z5c (more details), 2.2 Å

PDB Description: Topoisomerase VI-B, ADP Pi bound dimer form
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ca3 d.122.1.2 (A:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

SCOPe Domain Coordinates for d1z5ca3:

Click to download the PDB-style file with coordinates for d1z5ca3.
(The format of our PDB-style files is described here.)

Timeline for d1z5ca3: