Lineage for d1z5ba1 (1z5b A:229-306)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650358Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
  6. 650359Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 650360Species Archaeon Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 650362Domain d1z5ba1: 1z5b A:229-306 [124464]
    Other proteins in same PDB: d1z5ba2, d1z5ba3, d1z5bb2, d1z5bb3
    automatically matched to d1mu5a1
    complexed with adp, alf, mg, so4

Details for d1z5ba1

PDB Entry: 1z5b (more details), 2 Å

PDB Description: Topoisomerase VI-B, ADP AlF4- bound dimer form
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOP Domain Sequences for d1z5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ba1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOP Domain Coordinates for d1z5ba1:

Click to download the PDB-style file with coordinates for d1z5ba1.
(The format of our PDB-style files is described here.)

Timeline for d1z5ba1: