SCOP 1.75: Domain d1z5ab3: 1z5a B:9-228

Lineage for d1z5ab3 (1z5a B:9-228)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)

6. Protein Topoisomerase VI-B subunit [82778] (1 species)
   contains an H2TH domain inserted after this domain and before the second family-specific domain

7. Species Archaeon Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)

8. Domain d1z5ab3: 1z5a B:9-228 [124463]
   Other proteins in same PDB: d1z5aa1, d1z5aa2, d1z5ab1, d1z5ab2
   automatically matched to d1mx0a3
   complexed with adp, mg

Details for d1z5ab3

PDB Entry: 1z5a, 2.2 Å

PDB Description: Topoisomerase VI-B, ADP-bound dimer form

PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOP Domain Sequences for d1z5ab3:

Sequence; same for both SEQRES and ATOM records:

>d1z5ab3 d.122.1.2 (B:9-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]}
slspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidliddarq
iykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhqdkpie
ietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpkaksriy
eyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

Timeline for d1z5ab3:

• d1z5ab3 first appeared in SCOP 1.73
  
• d1z5ab3 appears in SCOPe 2.01
  
• d1z5ab3 appears in the current release, SCOPe 2.08