Lineage for d1z5ab2 (1z5a B:307-463)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930264Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2930301Protein Topoisomerase VI-B subunit [82577] (1 species)
    contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain
  7. 2930302Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries)
  8. 2930311Domain d1z5ab2: 1z5a B:307-463 [124462]
    Other proteins in same PDB: d1z5aa1, d1z5aa3, d1z5ab1, d1z5ab3
    automated match to d2hkja2
    complexed with adp, mg

Details for d1z5ab2

PDB Entry: 1z5a (more details), 2.2 Å

PDB Description: Topoisomerase VI-B, ADP-bound dimer form
PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ab2 d.14.1.3 (B:307-463) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqe

SCOPe Domain Coordinates for d1z5ab2:

Click to download the PDB-style file with coordinates for d1z5ab2.
(The format of our PDB-style files is described here.)

Timeline for d1z5ab2: