Lineage for d1z54d1 (1z54 D:1-130)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721378Family d.38.1.1: 4HBT-like [54638] (16 proteins)
    Pfam PF03061
  6. 721455Protein Probable thioesterase TTHA0908 [143152] (1 species)
  7. 721456Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)
  8. 721460Domain d1z54d1: 1z54 D:1-130 [124453]
    automatically matched to 1Z54 A:1-132
    complexed with gol

Details for d1z54d1

PDB Entry: 1z54 (more details), 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus
PDB Compounds: (D:) probable thioesterase

SCOP Domain Sequences for d1z54d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z54d1 d.38.1.1 (D:1-130) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
diyralsvlh

SCOP Domain Coordinates for d1z54d1:

Click to download the PDB-style file with coordinates for d1z54d1.
(The format of our PDB-style files is described here.)

Timeline for d1z54d1: