Lineage for d1z54a1 (1z54 A:1-132)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858718Protein Probable thioesterase TTHA0908 [143152] (1 species)
  7. 858719Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)
    Uniprot Q5SJV0 1-132
  8. 858720Domain d1z54a1: 1z54 A:1-132 [124450]
    complexed with gol

Details for d1z54a1

PDB Entry: 1z54 (more details), 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus
PDB Compounds: (A:) probable thioesterase

SCOP Domain Sequences for d1z54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
diyralsvlhlk

SCOP Domain Coordinates for d1z54a1:

Click to download the PDB-style file with coordinates for d1z54a1.
(The format of our PDB-style files is described here.)

Timeline for d1z54a1: