Lineage for d1z4na_ (1z4n A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1010856Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1010857Protein beta-Phosphoglucomutase [75174] (2 species)
  7. 1010858Species Lactococcus lactis [TaxId:1358] [75175] (13 PDB entries)
  8. 1010871Domain d1z4na_: 1z4n A: [124438]
    automated match to d1lvha_
    complexed with gl1, mg

Details for d1z4na_

PDB Entry: 1z4n (more details), 1.97 Å

PDB Description: structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d1z4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4na_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqk

SCOPe Domain Coordinates for d1z4na_:

Click to download the PDB-style file with coordinates for d1z4na_.
(The format of our PDB-style files is described here.)

Timeline for d1z4na_: