Lineage for d1z3eb1 (1z3e B:245-311)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642959Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 642960Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (1 protein)
  6. 642961Protein C-terminal domain of RNA polymerase alpha subunit [47791] (3 species)
  7. 642962Species Bacillus subtilis [TaxId:1423] [140637] (1 PDB entry)
  8. 642963Domain d1z3eb1: 1z3e B:245-311 [124401]
    Other proteins in same PDB: d1z3ea1
    complexed with so4

Details for d1z3eb1

PDB Entry: 1z3e (more details), 1.5 Å

PDB Description: crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d1z3eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]}
kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle
elglglr

SCOP Domain Coordinates for d1z3eb1:

Click to download the PDB-style file with coordinates for d1z3eb1.
(The format of our PDB-style files is described here.)

Timeline for d1z3eb1: