![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (1 protein) |
![]() | Protein C-terminal domain of RNA polymerase alpha subunit [47791] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140637] (1 PDB entry) |
![]() | Domain d1z3eb1: 1z3e B:245-311 [124401] Other proteins in same PDB: d1z3ea1 complexed with so4 |
PDB Entry: 1z3e (more details), 1.5 Å
SCOP Domain Sequences for d1z3eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]} kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle elglglr
Timeline for d1z3eb1: