Lineage for d1z3ea1 (1z3e A:1-114)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133575Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2133585Protein Regulatory protein Spx [142393] (1 species)
  7. 2133586Species Bacillus subtilis [TaxId:1423] [142394] (1 PDB entry)
    Uniprot O31602 1-114
  8. 2133587Domain d1z3ea1: 1z3e A:1-114 [124400]
    Other proteins in same PDB: d1z3ea2, d1z3eb1
    protein/RNA complex; complexed with so4

Details for d1z3ea1

PDB Entry: 1z3e (more details), 1.5 Å

PDB Description: crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit
PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d1z3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrfl

SCOPe Domain Coordinates for d1z3ea1:

Click to download the PDB-style file with coordinates for d1z3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z3ea2
View in 3D
Domains from other chains:
(mouse over for more information)
d1z3eb1