| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
| Protein Regulatory protein Spx [142393] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [142394] (1 PDB entry) Uniprot O31602 1-114 |
| Domain d1z3ea1: 1z3e A:1-114 [124400] Other proteins in same PDB: d1z3ea2, d1z3eb1 protein/RNA complex; complexed with so4 |
PDB Entry: 1z3e (more details), 1.5 Å
SCOPe Domain Sequences for d1z3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrfl
Timeline for d1z3ea1: