SCOPe 2.06: Domain d1z3da_: 1z3d A:

Lineage for d1z3da_ (1z3d A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [186897] (1 PDB entry)

8. Domain d1z3da_: 1z3d A: [124399]
   automated match to d1q34a_

Details for d1z3da_

PDB Entry: 1z3d, 2.5 Å

PDB Description: Protein crystal growth improvement leading to the 2.5A crystallographic structure of ubiquitin-conjugating enzyme (ubc-1) from Caenorhabditis elegans

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 1

SCOPe Domain Sequences for d1z3da_:

Sequence; same for both SEQRES and ATOM records:

>d1z3da_ d.20.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswlnf

Timeline for d1z3da_:

• d1z3da_ first appeared in SCOP 1.73, called d1z3da1
  
• d1z3da_ appears in SCOPe 2.05
  
• d1z3da_ appears in SCOPe 2.07
  
• d1z3da_ appears in the current release, SCOPe 2.08