Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [186897] (1 PDB entry) |
Domain d1z3da_: 1z3d A: [124399] automated match to d1q34a_ |
PDB Entry: 1z3d (more details), 2.5 Å
SCOPe Domain Sequences for d1z3da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3da_ d.20.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp anslaaqlyqenrreyekrvqqiveqswlnf
Timeline for d1z3da_: