Lineage for d1z3da1 (1z3d A:2-150)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720129Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (2 PDB entries)
  8. 720130Domain d1z3da1: 1z3d A:2-150 [124399]
    automatically matched to d1q34a_

Details for d1z3da1

PDB Entry: 1z3d (more details), 2.5 Å

PDB Description: Protein crystal growth improvement leading to the 2.5A crystallographic structure of ubiquitin-conjugating enzyme (ubc-1) from Caenorhabditis elegans
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 1

SCOP Domain Sequences for d1z3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswl

SCOP Domain Coordinates for d1z3da1:

Click to download the PDB-style file with coordinates for d1z3da1.
(The format of our PDB-style files is described here.)

Timeline for d1z3da1: